Structure of PDB 7oi8 Chain 8 Binding Site BS01

Receptor Information
>7oi8 Chain 8 (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKME
RDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPP
Ligand information
>7oi8 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oi8 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F88 K119 L123 K125 Q126 R129
Binding residue
(residue number reindexed from 1)		F6 K37 L41 K43 Q44 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009653 anatomical structure morphogenesis
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi8, PDBe:7oi8, PDBj:7oi8
PDBsum7oi8
PubMed34315873
UniProtQ9NQ50|RM40_HUMAN Large ribosomal subunit protein mL40 (Gene Name=MRPL40)

[Back to BioLiP]