Structure of PDB 7o9m Chain 8 Binding Site BS01

Receptor Information
>7o9m Chain 8 (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEA
LEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPP
Ligand information
>7o9m Chain B (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaacacaaagcacccaacuuacacuuaggagauucaauu
gacgcucuga
<<<<<...<<<........>>>.<<.<<.......>>.>>....<<<..>
>>.>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o9m Structural basis for late maturation steps of the human mitoribosomal large subunit.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K119 Q126
Binding residue
(residue number reindexed from 1)		K23 Q30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009653 anatomical structure morphogenesis
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o9m, PDBe:7o9m, PDBj:7o9m
PDBsum7o9m
PubMed34135318
UniProtQ9NQ50|RM40_HUMAN Large ribosomal subunit protein mL40 (Gene Name=MRPL40)

[Back to BioLiP]