Structure of PDB 8snb Chain 7U Binding Site BS01

Receptor Information
>8snb Chain 7U (length=93) Species: 7668 (Strongylocentrotus purpuratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNETITDLVKRERLTSTYVRQCPGYAGYRPRSPLRIPMENLNEPNLRMTT
TMKASYRPLMFPLINMDHFPHMGPMSRTVTLTYPCNPFNKVEK
Ligand information
>8snb Chain 9V (length=24) Species: 7668 (Strongylocentrotus purpuratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEGTSDLQYIWRGAPGAPPPRRRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8snb Structural specializations of the sperm tail.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
R175 F186
Binding residue
(residue number reindexed from 1)
R77 F88
External links