Structure of PDB 8qpa Chain 7 Binding Site BS01

Receptor Information
>8qpa Chain 7 (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAP
GLDIESSLKQLAERRTDIFGVEETAIGKKIG
Ligand information
>8qpa Chain 4 (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuauugcuaau
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpa Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution3.7 Å
Binding residue
(original residue number in PDB)
R430 I431 L434 D435 R437 W438 R444
Binding residue
(residue number reindexed from 1)
R22 I23 L26 D27 R29 W30 R36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8qpa, PDBe:8qpa, PDBj:8qpa
PDBsum8qpa
PubMed38778104
UniProtQ15459|SF3A1_HUMAN Splicing factor 3A subunit 1 (Gene Name=SF3A1)

[Back to BioLiP]