Structure of PDB 7zag Chain 7 Binding Site BS01

Receptor Information
>7zag Chain 7 (length=130) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVIRLYPDERYVFRRSNPAIVGIEVIEGRIKPGVTLIKQNGQKVGVIRSI
KSRDEFLQEAKKGQAVAIAIEGAIVGRHIHPGETLYVDLSRDDAITLLKH
LRDTLEDTDIKALKMIAKVKAKEDPFWRAI
Ligand information
>7zag Chain 4 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcuacca
<<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zag Role of aIF5B in archaeal translation initiation.
Resolution2.77 Å
Binding residue
(original residue number in PDB)		F481 R482 R483 I488 R516 S517 K519 A537 R545
Binding residue
(residue number reindexed from 1)		F13 R14 R15 I20 R48 S49 K51 A69 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0003924 GTPase activity
GO:0005525 GTP binding
Biological Process
GO:0006413 translational initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7zag, PDBe:7zag, PDBj:7zag
PDBsum7zag
PubMed35694843
UniProtQ9UZK7|IF2P_PYRAB Probable translation initiation factor IF-2 (Gene Name=infB)

[Back to BioLiP]