Structure of PDB 5luf Chain 7 Binding Site BS01

Receptor Information
>5luf Chain 7 (length=56) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCL
GWASFP
Ligand information
>5luf Chain w (length=22) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RNWVPTAQLWGAVGAVGLVSAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5luf Functional asymmetry and electron flow in the bovine respirasome.
Resolution9.1 Å
Binding residue
(original residue number in PDB)		F1 E2
Binding residue
(residue number reindexed from 1)		F1 E2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0045277 respiratory chain complex IV

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5luf, PDBe:5luf, PDBj:5luf
PDBsum5luf
PubMed27830641
UniProtP07470|CX7A1_BOVIN Cytochrome c oxidase subunit 7A1, mitochondrial (Gene Name=COX7A1)

[Back to BioLiP]