Structure of PDB 8h6e Chain 6a Binding Site BS01

Receptor Information

>8h6e Chain 6a (length=89) Species: 9606 (Homo sapiens)

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEK
YPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKE

Ligand information

>8h6e Chain 6A (length=59)

acgauacagagaagauuagcauggccccugcgcaaggaugacauucguga
agcguauuu

..................................................
.........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8h6e Structural Insights into Human Exon-defined Spliceosome Prior to Activation
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): Y35 S65
• Binding residue (residue number reindexed from 1): Y35 S65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0017070 U6 snRNA binding
• GO:0031267 small GTPase binding

Biological Process

• GO:0000244 spliceosomal tri-snRNP complex assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0006402 mRNA catabolic process
• GO:0008380 RNA splicing

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:0120115 Lsm2-8 complex
• GO:1990726 Lsm1-7-Pat1 complex

External links

• PDB: RCSB:8h6e, PDBe:8h6e, PDBj:8h6e
• PDBsum: 8h6e
• PubMed: 38658629
• UniProt: Q9Y333|LSM2_HUMAN U6 snRNA-associated Sm-like protein LSm2 (Gene Name=LSM2)