Structure of PDB 8rm5 Chain 63 Binding Site BS01

Receptor Information
>8rm5 Chain 63 (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTT
IEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPP
Ligand information
>8rm5 Chain 6 (length=64) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uggaacgauacagagaagauuagcauggccccugcgcaaggaugacauuc
gugaagcguauuuu
..................................................
..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rm5 Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution6.9 Å
Binding residue
(original residue number in PDB)		G89 D90
Binding residue
(residue number reindexed from 1)		G76 D77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030629 U6 snRNA 3'-end binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rm5, PDBe:8rm5, PDBj:8rm5
PDBsum8rm5
PubMed38778104
UniProtP62310|LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 (Gene Name=LSM3)

[Back to BioLiP]