Structure of PDB 6esb Chain 6 Binding Site BS01

Receptor Information

>6esb Chain 6 (length=345) Species: 1891762 (Betapolyomavirus hominis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVECFLNPEMGDPDENLRG
FSLKLSAENDFSSDSPERKMLPCYSTARIPLPNLNEDLTCGNLLMWEAVT
VQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNFHFFAVGGDPLEMQGV
LMNYRTKYPDGTITPKNPTAQSQVMNTDHKAYLDKNNAYPVECWVPDPSR
NENTRYFGTFTGGENVPPVLHVTNTATTVLLDEQGVGPLCKADSLYVSAA
DICGLFTNSSGTQQWRGLARYFKIRLRKRSVKNPYPISFLLSDLINRRTQ
RVDGQPMYGMESQVEEVRVFDGTERLPGDPDMIRYIDKQGQLQTK

Ligand information

>6esb Chain 7 (length=14) Species: 1891762 (Betapolyomavirus hominis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TAPQWMLPLLLGLY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6esb The Structure of an Infectious Human Polyomavirus and Its Interactions with Cellular Receptors.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	Q116 N238 T239 A240 T241 L245
Binding residue (residue number reindexed from 1)	Q102 N224 T225 A226 T227 L231

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Biological Process
GO:0019062	virion attachment to host cell
GO:0046718	symbiont entry into host cell
GO:0075513	caveolin-mediated endocytosis of virus by host cell

	Cellular Component
GO:0019028	viral capsid
GO:0039620	T=7 icosahedral viral capsid
GO:0042025	host cell nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6esb, PDBe:6esb, PDBj:6esb
PDBsum	6esb
PubMed	29706532
UniProt	P03088\|VP1_POVBK Major capsid protein VP1

[Back to BioLiP]