Structure of PDB 7d63 Chain 5K Binding Site BS01

Receptor Information
>7d63 Chain 5K (length=175) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKFGLVKRTLNTKKDQRLKKNQENLTRNIPQVSSALFFQYNQAIKPPYQ
VLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYR
IALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRI
RKIPGIPLMSVGGHAYVIEKLPDVF
Ligand information
>7d63 Chain 3A (length=175) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccagugagaaauugccguugcuauggcgcgaugaucacccaugggu
ggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<<<<..<.........<<<<......>>>>........><<<<..>>>>
.>>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d63 Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
Resolution12.3 Å
Binding residue
(original residue number in PDB)
Q23 K133 G134
Binding residue
(residue number reindexed from 1)
Q17 K119 G120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7d63, PDBe:7d63, PDBj:7d63
PDBsum7d63
PubMed
UniProtQ05498|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)

[Back to BioLiP]