Structure of PDB 6ke6 Chain 5J Binding Site BS01

Receptor Information
>6ke6 Chain 5J (length=144) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKFQEIETNLKKLPKLETGFDALANKKKKKNVLPSNDWFTLPKPDDNMRR
EVQRDLLLIKHRAALDPKRHYKKQRWEVPERFAIGTIIEDKMNRKERKST
ILETLMGDEASNKYFKRKYNEIQEKSTSGRKAHYKKMKEMRKKR
Ligand information
>6ke6 Chain 3A (length=175) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccagugagaaauugccguugcuauggcgcgaugaucacccaugggu
ggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<<<<..<.........<<<<......>>>>........><<<<..>>>>
.>>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ke6 3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)
N112 R166 K167
Binding residue
(residue number reindexed from 1)
N47 R94 K95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ke6, PDBe:6ke6, PDBj:6ke6
PDBsum6ke6
PubMed
UniProtQ12035|FCF2_YEAST rRNA-processing protein FCF2 (Gene Name=FCF2)

[Back to BioLiP]