Structure of PDB 6lqu Chain 5F Binding Site BS01

Receptor Information
>6lqu Chain 5F (length=182) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRIC
GDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKV
TVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVT
RNMEDYVTWVDNSKIKKTLLRYRNQIDDFDFS
Ligand information
>6lqu Chain 3A (length=175) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccagugagaaauugccguugcuauggcgcgaugaucacccaugggu
ggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<<<<..<.........<<<<......>>>>.......>.<<<<..>>>>
.>>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqu Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
H7 H8 K11 L13 K14 K15 Q133 H135 K165
Binding residue
(residue number reindexed from 1)
H6 H7 K10 L12 K13 K14 Q132 H134 K164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030515 snoRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0034457 Mpp10 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6lqu, PDBe:6lqu, PDBj:6lqu
PDBsum6lqu
PubMed32943522
UniProtP32899|IMP3_YEAST U3 small nucleolar ribonucleoprotein protein IMP3 (Gene Name=IMP3)

[Back to BioLiP]