Structure of PDB 6lqt Chain 5D Binding Site BS01

Receptor Information

>6lqt Chain 5D (length=70) Species: 559292 (Saccharomyces cerevisiae S288C)

AKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVL
REKAKERNPDEYYHAMHSRK

Ligand information

>6lqt Chain 3A (length=194)

gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guaccccagagugagaaauugccguugcauuuuauggcgcgaugaucuug
acccauccuauagggggguggguacaaauggcagucugacaagu

..................................................
.......................<<<<<.................<<<<<
<<..<<....<.........<<<............>>>........>...
<<<..<<<<..>>>>.>>>.>>.>>>>>.>>........>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6lqt Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
• Resolution: 4.9 Å
• Binding residue (original residue number in PDB): H65 H68
• Binding residue (residue number reindexed from 1): H64 H67

Gene Ontology

Molecular Function

• GO:0003674 molecular_function

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6lqt, PDBe:6lqt, PDBj:6lqt
• PDBsum: 6lqt
• PubMed: 32943522
• UniProt: P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 (Gene Name=UTP11)