Structure of PDB 6lqs Chain 5D Binding Site BS01

Receptor Information
>6lqs Chain 5D (length=204) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVL
REKAKERNPDEYYHAMHSRKSNYVRTLRQIELKKLEKGAKQLMFKSSGNH
TIFVDSREKMNEFTPEKFFNTTSEMVNRSENRLTKDQLAPKESLDKKKLK
KFKQVKQHLQRETQLKQVQQRMDAQRELLKKGSKKKIVDSSGKISFKWKK
QRKR
Ligand information
>6lqs Chain 3A (length=234) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guaccccagagugagaaauagcuuggccgaaucgguucggccacuauauu
gccguugcauuuuauggcgcgaugaucuugacccauccuaucuucgaaga
uagggggguggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<..<<....<............<<<<<<<<<..>>>>>>>>>.......
<<<............>>>........>...<<<..<<<<<<<<<..>>>>
>>>>>.>>>.>>.>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqs Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H65 H68 R108 Q112 I113 K116 K117 K120 K226 K227 K249 R250
Binding residue
(residue number reindexed from 1)		H64 H67 R75 Q79 I80 K83 K84 K87 K180 K181 K203 R204
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqs, PDBe:6lqs, PDBj:6lqs
PDBsum6lqs
PubMed32943522
UniProtP34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 (Gene Name=UTP11)

[Back to BioLiP]