Structure of PDB 8gzu Chain 52 Binding Site BS01

Receptor Information
>8gzu Chain 52 (length=97) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDFEYNNQDVNQLNGAFISLVEDEKIGFWVGVGGFAYSQFIMRKFVKSTN
IFASVTSLFAGAALANLYTHQSRASYARVAARANRNASLALNKLMEY
Ligand information
>8gzu Chain 54 (length=17) Species: 312017 (Tetrahymena thermophila SB210) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gzu Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae.
Resolution4.18 Å
Binding residue
(original residue number in PDB)		L70 Y71
Binding residue
(residue number reindexed from 1)		L67 Y68
External links