Structure of PDB 8fxp Chain 5 Binding Site BS01

Receptor Information
>8fxp Chain 5 (length=137) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF
YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA
GTVPCMNGQWISIAPATGSETNAANVQITVTMKGATR
Ligand information
>8fxp Chain 0D (length=19) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDCRNLCGAAAPSRLVQPG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fxp Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution4.04 Å
Binding residue
(original residue number in PDB)		V87 D96 S97 F98 C99 A100
Binding residue
(residue number reindexed from 1)		V87 D96 S97 F98 C99 A100
Enzymatic activity
Enzyme Commision number ?
External links