Structure of PDB 8b9b Chain 5 Binding Site BS01

Receptor Information
>8b9b Chain 5 (length=533) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIG
YNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSLPTFQLILNSNANQI
PLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINN
FNVSLPRSCLSNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRN
LTMTCDRYLTNKVIPGTRVTIVGIYSIYNSGVAIRTPYIKILGIQSMFTE
EEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILP
DGMRLRGDINVLLLAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRR
EFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGIT
TVLNSRTSVLAAANTTILSRFDMIFIVKDDHNEERDISIANHVINIHTEI
SIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINPITIRQLE
AIIRITESLAKLELSPIAQERHVDEAIRLFQAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b9b How Pol alpha-primase is targeted to replisomes to prime eukaryotic DNA replication.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
V453 K506 A507
Binding residue
(residue number reindexed from 1)
V347 K396 A397
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0003697 single-stranded DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:0043138 3'-5' DNA helicase activity
Biological Process
GO:0000727 double-strand break repair via break-induced replication
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006270 DNA replication initiation
GO:0006279 premeiotic DNA replication
GO:0006368 transcription elongation by RNA polymerase II
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0031507 heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0032508 DNA duplex unwinding
GO:0033260 nuclear DNA replication
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005737 cytoplasm
GO:0031261 DNA replication preinitiation complex
GO:0031298 replication fork protection complex
GO:0042555 MCM complex
GO:0043596 nuclear replication fork
GO:0071162 CMG complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8b9b, PDBe:8b9b, PDBj:8b9b
PDBsum8b9b
PubMed37506699
UniProtP29496|MCM5_YEAST Minichromosome maintenance protein 5 (Gene Name=MCM5)

[Back to BioLiP]