Structure of PDB 8h6j Chain 4S Binding Site BS01

Receptor Information
>8h6j Chain 4S (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMK
KLDEEALLKKM
Ligand information
>8h6j Chain 4A (length=125) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugaggucuauccgaggcgcg
auuuugcuaauugaaaacuucccaauagccgugacgacuagucggcacug
gcaauuuuugacagucucgagacug
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>.........................<<<<<<.<<<<..>>>>.>>>.>
>>.........<<<<<<<>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6j Atomic structures of human exon-defined spliceosome prior to activation.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		K723 R727 S730 H731 S738 G739 K740 M741 K742 R745 K749
Binding residue
(residue number reindexed from 1)		K25 R29 S32 H33 S40 G41 K42 M43 K44 R47 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000481 maturation of 5S rRNA
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045585 positive regulation of cytotoxic T cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6j, PDBe:8h6j, PDBj:8h6j
PDBsum8h6j
PubMed38658629
UniProtO43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 (Gene Name=SART1)

[Back to BioLiP]