Structure of PDB 8h6k Chain 4N Binding Site BS01

Receptor Information
>8h6k Chain 4N (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKH
QRNLGMSMRVERSTLDQVKKRFEVNKKKME
Ligand information
>8h6k Chain A (length=64) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuccuugaagcuuucgugcugacccugucccuuuuuuuuccacccuacc
aggugaguauggau
..................................................
..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		D97 H98 G101 K102 K103
Binding residue
(residue number reindexed from 1)		D43 H44 G47 K48 K49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum8h6k
PubMed38658629
UniProtQ96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 (Gene Name=ZMAT2)

[Back to BioLiP]