Structure of PDB 8h6k Chain 4K Binding Site BS01

Receptor Information

>8h6k Chain 4K (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENK
RENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAE
LRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDH
FNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAW

Ligand information

>8h6k Chain A (length=64) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuccuugaagcuuucgugcugacccugucccuuuuuuuuccacccuacc
aggugaguauggau

..................................................
..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y335 F337 K340 Y341 K381 Y391 H393 L394 V395
Binding residue (residue number reindexed from 1)	Y117 F119 K122 Y123 K163 Y173 H175 L176 V177

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0001527	microfibril
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005813	centrosome
GO:0071005	U2-type precatalytic spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum	8h6k
PubMed	38658629
UniProt	P55081\|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)

[Back to BioLiP]