Structure of PDB 8h6k Chain 4F Binding Site BS01

Receptor Information

>8h6k Chain 4F (length=141) Species: 9606 (Homo sapiens)

SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Ligand information

>8h6k Chain A (length=64)

uuuccuugaagcuuucgugcugacccugucccuuuuuuuuccacccuacc
aggugaguauggau

..................................................
..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): G95 T96 G97 N98 S137
• Binding residue (residue number reindexed from 1): G94 T95 G96 N97 S136

Gene Ontology

Molecular Function

• GO:0005515 protein binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0051301 cell division

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005829 cytosol
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
• PDBsum: 8h6k
• PubMed: 38658629
• UniProt: P83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)