Structure of PDB 8h6e Chain 4D Binding Site BS01

Receptor Information
>8h6e Chain 4D (length=327) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLWDSKMFAEIMMKIEEYISKQAKASEVAAPEYRVIVDANNLTVEIENE
LNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQ
QILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYE
YVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQR
KTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVD
SFHESTEGKVGYELKDEIERKFDKWQEKPLPAPLDGQRKKRGGRRYRKMK
ERLGLTEIRKQANRMSFGEIEEDAYQE
Ligand information
>8h6e Chain 6A (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgauacagagaagauuagcauggccccugcgcaaggaugacauucguga
agcguauuu
..................................................
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6e Structural Insights into Human Exon-defined Spliceosome Prior to Activation
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R351 K352 K353 R354 G355 G356 R357 R360
Binding residue
(residue number reindexed from 1)		R288 K289 K290 R291 G292 G293 R294 R297
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070990 snRNP binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0048254 snoRNA localization
GO:0071166 ribonucleoprotein complex localization
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005687 U4 snRNP
GO:0005690 U4atac snRNP
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071339 MLL1 complex
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6e, PDBe:8h6e, PDBj:8h6e
PDBsum8h6e
PubMed38658629
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]