Structure of PDB 8h6l Chain 4B Binding Site BS01

Receptor Information
>8h6l Chain 4B (length=256) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEIEWWDSYIIFGITNLVEHPAQLNPPVTLGVYLTKKEQKKLRRQTRREA
QKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAK
RQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAK
KFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDT
NKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSES
VLESTD
Ligand information
>8h6l Chain 6A (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgauacagagaagauuagcauggccccugcgcaaggaugacauucguga
agcguauuu
..................................................
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6l Structural Insights into Human Exon-defined Spliceosome Prior to Activation
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q457 K475 R477 N480 N515 R518 K519 L520 K528 F558 K559 Q566 K589 R596 R601
Binding residue
(residue number reindexed from 1)		Q51 K69 R71 N74 N109 R112 K113 L114 K122 F152 K153 Q160 K183 R190 R195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6l, PDBe:8h6l, PDBj:8h6l
PDBsum8h6l
PubMed38658629
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]