Structure of PDB 8h6j Chain 4B Binding Site BS01

Receptor Information
>8h6j Chain 4B (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEIEWWDSYIIFGITNLVEHPAQLNPPGVYLTKKEQKKLRRQTRREAQKE
LQEKVRLGLMPPPEPKVISQGVHISVYRVRNLSNPAKKFKIEANAGQLYL
TGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
Ligand information
>8h6j Chain 6A (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuggaaaagauuagcauggccccugcgcaaggaugacauucgugaagcgu
auuu
..................................................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h6j Atomic structures of human exon-defined spliceosome prior to activation.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		A562 N563
Binding residue
(residue number reindexed from 1)		A93 N94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6j, PDBe:8h6j, PDBj:8h6j
PDBsum8h6j
PubMed38658629
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]