Structure of PDB 8wkq Chain 4 Binding Site BS01

Receptor Information
>8wkq Chain 4 (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT
EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT
KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK
RGDTLNVVNSPFSA
Ligand information
>8wkq Chain j (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wkq Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		P355 S357
Binding residue
(residue number reindexed from 1)		P80 S82
External links
PDB RCSB:8wkq, PDBe:8wkq, PDBj:8wkq
PDBsum8wkq
PubMed
UniProtP15928|FLIF_SALTY Flagellar M-ring protein (Gene Name=fliF)

[Back to BioLiP]