Structure of PDB 8i0v Chain 4 Binding Site BS01

Receptor Information
>8i0v Chain 4 (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFL
SEEDADYAIKIMNMIKLYGKPIRVNKADVGANIFIGNLDPEIDEKLLYDT
FSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCN
RPITVSYAFKK
Ligand information
>8i0v Chain G (length=79) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggccuccgaacgguaagagccuagcauguagaacugguuaccuaugaug
ucauacuuauccugucccuuuuuuuucca
..................................................
.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0v Molecular basis for the activation of human spliceosome
Resolution3.0 Å
Binding residue
(original residue number in PDB)		E22 V49
Binding residue
(residue number reindexed from 1)		E10 V37
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:1990935 splicing factor binding
Biological Process
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0v, PDBe:8i0v, PDBj:8i0v
PDBsum8i0v
PubMed39068178
UniProtQ15427|SF3B4_HUMAN Splicing factor 3B subunit 4 (Gene Name=SF3B4)

[Back to BioLiP]