Structure of PDB 8a57 Chain 4 Binding Site BS01

Receptor Information
>8a57 Chain 4 (length=59) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTGIHPEYRPVVFVDTSTDFKFLSGSTKSSSETIKWEDGNEYPLLRVEI
SSDSHPFYT
Ligand information
>8a57 Chain B (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugguaguuauggcgagaaggucacacccguucccauaccgaacacggua
guuaagcuucucugcgccaaugguaguugggggcuucccccugcgagagu
aggucgcugccggg
<<<<<<<<....<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>><<<.......<<.<<<<<...>>>>>.>>......
.>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a57 Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		M1 K2 H6
Binding residue
(residue number reindexed from 1)		M1 K2 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a57, PDBe:8a57, PDBj:8a57
PDBsum8a57
PubMed36300626
UniProtP0A485|RL31B_LISMO Large ribosomal subunit protein bL31B (Gene Name=rpmE2)

[Back to BioLiP]