Structure of PDB 7pxd Chain 4 Binding Site BS01

Receptor Information

>7pxd Chain 4 (length=215) Species: 1773 (Mycobacterium tuberculosis)

SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL

Ligand information

>7pxd Chain 1 (length=5) Species: 1773 (Mycobacterium tuberculosis)

LGQYL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7pxd Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
• Resolution: 4.0 Å
• Binding residue (original residue number in PDB): F111 D144 S146
• Binding residue (residue number reindexed from 1): F104 D137 S139

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0010498 proteasomal protein catabolic process
• GO:0019941 modification-dependent protein catabolic process
• GO:0030682 symbiont-mediated perturbation of host defenses
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall
• GO:0019773 proteasome core complex, alpha-subunit complex

External links

• PDB: RCSB:7pxd, PDBe:7pxd, PDBj:7pxd
• PDBsum: 7pxd
• PubMed: 35022401
• UniProt: P9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)