Structure of PDB 7pxc Chain 4 Binding Site BS01

Receptor Information
>7pxc Chain 4 (length=215) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELY
DRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLANVYAQTL
GTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMG
GTTEPIANALKESYAENASLTDALRIAVAALRALGVASLEVAVLDANRPR
RAFRRITGSALQALL
Ligand information
>7pxc Chain 1 (length=5) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LGQYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pxc Structural basis of prokaryotic ubiquitin-like protein engagement and translocation by the mycobacterial Mpa-proteasome complex.
Resolution3.84 Å
Binding residue
(original residue number in PDB)		F111 D144 S146
Binding residue
(residue number reindexed from 1)		F104 D137 S139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
Biological Process
GO:0010498 proteasomal protein catabolic process
GO:0019941 modification-dependent protein catabolic process
GO:0030682 symbiont-mediated perturbation of host defenses
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005737 cytoplasm
GO:0005839 proteasome core complex
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0019773 proteasome core complex, alpha-subunit complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pxc, PDBe:7pxc, PDBj:7pxc
PDBsum7pxc
PubMed35022401
UniProtP9WHU1|PSA_MYCTU Proteasome subunit alpha (Gene Name=prcA)

[Back to BioLiP]