Structure of PDB 7ns3 Chain 4 Binding Site BS01

Receptor Information
>7ns3 Chain 4 (length=199) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVCTNYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGF
LSIRGLTNQHPEISTYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTD
LEHWINFPSFRQLFISRIFSQEKQFDNYLNERFIFMKWKEKFLVPDAVDG
ASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLESSDCSFEFA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ns3 GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		E294 A310 S311 Y331
Binding residue
(residue number reindexed from 1)		E140 A151 S152 Y172
External links