Structure of PDB 7dco Chain 4 Binding Site BS01

Receptor Information
>7dco Chain 4 (length=174) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEF
YNQGDAQYAIKIMNNTVRLYDRLIKVRQVPIAKLFIKNLADSIDSDQLVK
IFNKFGKLIREPEIFYLSKLKCAYVYFEDFEKADLAIKSLNNQLVANNRI
TVDYAFKNGKGNAKYGDDVDRLLN
Ligand information
>7dco Chain G (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaauaaaaaaaaaaaaauuuguaagguauguauuauuuuuuaaaaaaaa
aaaaaaaaaaacuagauacuaacacauuuaauuuuuuuuuguuuuuuuuu
uuuuu
..................................................
..................................................
.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dco Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T10 Y12 K39 D43 K44 Y52 F54 R84 V86
Binding residue
(residue number reindexed from 1)		T3 Y5 K32 D36 K37 Y45 F47 R77 V79
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 09:07:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7dco', asym_id = '4', bs = 'BS01', title = 'Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7dco', asym_id='4', bs='BS01', title='Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003723', uniprot = '', pdbid = '7dco', asym_id = '4'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723', uniprot='', pdbid='7dco', asym_id='4')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>