Structure of PDB 1qgc Chain 4 Binding Site BS01

Receptor Information
>1qgc Chain 4 (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATISCRASESVDSSGHSFMHWYQQKPGQPPKL
LIYRASNLESGIPDRFSGSGSRTDFTLTIDPVEADDVATYYCQQSNEVPL
TFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRNEC
Ligand information
>1qgc Chain 5 (length=24) Species: 12116 (Foot and mouth disease virus C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TTAYTASARGDLAHLTTTAARTLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qgc Structure of the complex of an Fab fragment of a neutralizing antibody with foot-and-mouth disease virus: positioning of a highly mobile antigenic loop.
Resolution30.0 Å
Binding residue
(original residue number in PDB)		S31 H34
Binding residue
(residue number reindexed from 1)		S31 H34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030183 B cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005886 plasma membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qgc, PDBe:1qgc, PDBj:1qgc
PDBsum1qgc
PubMed9130694
UniProtP01837|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]