Structure of PDB 7ymm Chain 3M Binding Site BS01

Receptor Information
>7ymm Chain 3M (length=31) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNDLGAIATALFVFIPCVFLILLYAQTASRG
Ligand information
>7ymm Chain 3T (length=28) Species: 329726 (Acaryochloris marina MBIC11017) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDVIAYVFILACIIGLFFFAVFFREKPT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ymm Structure of a large photosystem II supercomplex from Acaryochloris marina.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		V3 A8
Binding residue
(residue number reindexed from 1)		V1 A6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ymm, PDBe:7ymm, PDBj:7ymm
PDBsum7ymm
PubMed38394197
UniProtB0CFM0|PSBM_ACAM1 Photosystem II reaction center protein M (Gene Name=psbM)

[Back to BioLiP]