Structure of PDB 6lqv Chain 3E Binding Site BS01

Receptor Information
>6lqv Chain 3E (length=431) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNS
AANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLG
LNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKL
KFVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYA
RIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNIN
ALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSL
ISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNK
GKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDL
RTTPKVVREAKKVEMTEARAYNADADTAKAA
Ligand information
>6lqv Chain 3A (length=175) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccagugagaaauugccguugcuauggcgcgaugaucacccaugggu
ggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<<<<..<.........<<<<......>>>>........><<<<..>>>>
.>>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqv Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		R298 H302 T316 Q318 I319 L320 E323 K324 F327 R328 K331 D335 T336 P337 K338 G340 K354 G357 K358 R361 V362 A365 K366 R397
Binding residue
(residue number reindexed from 1)		R292 H296 T310 Q312 I313 L314 E317 K318 F321 R322 K325 D329 T330 P331 K332 G334 K348 G351 K352 R355 V356 A359 K360 R391
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017069 snRNA binding
GO:0030515 snoRNA binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000452 snoRNA guided rRNA 2'-O-methylation
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:1902570 protein localization to nucleolus
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqv, PDBe:6lqv, PDBj:6lqv
PDBsum6lqv
PubMed32943522
UniProtQ12499|NOP58_YEAST Nucleolar protein 58 (Gene Name=NOP58)

[Back to BioLiP]