Structure of PDB 6lqt Chain 3C Binding Site BS01

Receptor Information
>6lqt Chain 3C (length=225) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVKVEYRVWNPF
RSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAV
EFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQP
DQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREER
IKPLEQLTLEPYERDHCIVVGRYMR
Ligand information
>6lqt Chain 3A (length=194) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guaccccagagugagaaauugccguugcauuuuauggcgcgaugaucuug
acccauccuauagggggguggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<..<<....<.........<<<............>>>........>...
<<<..<<<<..>>>>.>>>.>>.>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqt Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		E115 S116 V117 Y118
Binding residue
(residue number reindexed from 1)		E30 S31 V32 Y33
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008171 O-methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:1990259 histone H2AQ104 methyltransferase activity
Biological Process
GO:0000451 rRNA 2'-O-methylation
GO:0000452 snoRNA guided rRNA 2'-O-methylation
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006338 chromatin remodeling
GO:0006356 regulation of transcription by RNA polymerase I
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqt, PDBe:6lqt, PDBj:6lqt
PDBsum6lqt
PubMed32943522
UniProtP15646|FBRL_YEAST rRNA 2'-O-methyltransferase fibrillarin (Gene Name=NOP1)

[Back to BioLiP]