Structure of PDB 8iue Chain 3 Binding Site BS01

Receptor Information
>8iue Chain 3 (length=374) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGDLSLREPAADS
DREDAAVARDLDCSLEAAAELRAVCGLDKLKEVIPENTDLVTLGVRKRFL
EHREETITIDRACRQETFVYEMESHAIGKKPENSADMIEEGELILSVNIL
YPVIFHKHKEHKPYQTMLVLGSQKLTQLRDSIRCVSDLQIGGEFSNTPDQ
APEHISKDLYKSAFFYFEGTFYNDKRYPECRDLSRTIIEWSESHDRGYGK
FQTARMEDFTFNDLCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDR
TLYPLLIKKHWLWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRML
HYDSEGNKLGEFLAYPYVDPGTFN
Ligand information
>8iue Chain X (length=74) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatgcttaccgtaacttgaaagtatttcgatttcttggctttatatatc
ttgtggaaaggacgcttcggcagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iue Structure of the SNAPc-bound RNA polymerase III preinitiation complex.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		T143 I144 F192 H193 K194 P200 W350
Binding residue
(residue number reindexed from 1)		T106 I107 F155 H156 K157 P163 W313
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0005515 protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006383 transcription by RNA polymerase III
GO:0009301 snRNA transcription
GO:0042795 snRNA transcription by RNA polymerase II
GO:0042796 snRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0016604 nuclear body
GO:0019185 snRNA-activating protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iue, PDBe:8iue, PDBj:8iue
PDBsum8iue
PubMed37165065
UniProtQ92966|SNPC3_HUMAN snRNA-activating protein complex subunit 3 (Gene Name=SNAPC3)

[Back to BioLiP]