Structure of PDB 6sko Chain 3 Binding Site BS01

Receptor Information
>6sko Chain 3 (length=336) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMG
GVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGS
SGVGLTAAVTTDERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVME
QQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLS
RFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRPKLVTIPF
LRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETL
IRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sko Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		S438 V440 A445 V446 K499
Binding residue
(residue number reindexed from 1)		S101 V103 A108 V109 K158
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0003697 single-stranded DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:1904931 MCM complex binding
Biological Process
GO:0000727 double-strand break repair via break-induced replication
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006270 DNA replication initiation
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006279 premeiotic DNA replication
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0032508 DNA duplex unwinding
GO:1902975 mitotic DNA replication initiation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005737 cytoplasm
GO:0031261 DNA replication preinitiation complex
GO:0031298 replication fork protection complex
GO:0042555 MCM complex
GO:0043596 nuclear replication fork
GO:0071162 CMG complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sko, PDBe:6sko, PDBj:6sko
PDBsum6sko
PubMed32369734
UniProtP24279|MCM3_YEAST DNA replication licensing factor MCM3 (Gene Name=MCM3)

[Back to BioLiP]