Structure of PDB 6fti Chain 3 Binding Site BS01

Receptor Information
>6fti Chain 3 (length=120) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRV
NGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVL
LSFFMARVFMRMKLPGYLMG
Ligand information
>6fti Chain 0 (length=24) Species: 9615 (Canis lupus familiaris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fti Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		F118 R136
Binding residue
(residue number reindexed from 1)		F89 R107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006486 protein glycosylation
Cellular Component
GO:0008250 oligosaccharyltransferase complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fti, PDBe:6fti, PDBj:6fti
PDBsum6fti
PubMed29519914
UniProtP86218|OSTC_CANLF Oligosaccharyltransferase complex subunit OSTC (Gene Name=OSTC)

[Back to BioLiP]