Structure of PDB 5o5p Chain 3 Binding Site BS01

Receptor Information

>5o5p Chain 3 (length=235) Species: 12086 (Poliovirus 3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLPVLNTPGSNQYLTSDNYQSPCAIPEFDVTPPIDIPGEVKNMMELAEID
TMIPLNLENTKRNTMDMYRVTLSDSADLSQPILCFSLSPASDPRLSHTML
GEVLNYYTHWAGSLKFTFLFCGSMMATGKILVAYAPPGAQPPTSRKEAML
GTHVIWDLGLQSSCTMVVPWISNVTYRQTTQDSFTEGGYISMFYQTRIVV
PLSTPKSMSMLGFVSACNDFSVRLLRDTTHISQSA

Ligand information

>5o5p Chain 4 (length=17) Species: 12086 (Poliovirus 3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

INYTTINYYKDSASNAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5o5p Plant-made polio type 3 stabilized VLPs-a candidate synthetic polio vaccine.
Resolution	4.1 Å
Binding residue (original residue number in PDB)	N18 Q20 S21 P22 C23 E27
Binding residue (residue number reindexed from 1)	N18 Q20 S21 P22 C23 E27

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

View graph for
Molecular Function

External links

PDB	RCSB:5o5p, PDBe:5o5p, PDBj:5o5p
PDBsum	5o5p
PubMed	28811473
UniProt	Q84895

[Back to BioLiP]