Structure of PDB 2bpa Chain 3 Binding Site BS01

Receptor Information
>2bpa Chain 3 (length=36) Species: 10847 (Sinsheimervirus phiX174) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bpa Atomic structure of single-stranded DNA bacteriophage phi X174 and its functional implications.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G26 A27 R28 Y31
Binding residue
(residue number reindexed from 1)		G25 A26 R27 Y30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2bpa, PDBe:2bpa, PDBj:2bpa
PDBsum2bpa
PubMed1370343
UniProtP69592|J_BPPHS DNA-binding protein J (Gene Name=J)

[Back to BioLiP]