Structure of PDB 8snb Chain 2R Binding Site BS01

Receptor Information
>8snb Chain 2R (length=120) Species: 7668 (Strongylocentrotus purpuratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEMGEEEEFKRQMLAKFEEDDRIEQMNAQRRRMKQQEHKRRVEDLLADRR
AQFAADKERERDEREEAENLERLRMQIIEEERQRLLKEHASKLLGFLPKG
VIRNEQDLELFDDDFKRNYS
Ligand information
>8snb Chain 9V (length=24) Species: 7668 (Strongylocentrotus purpuratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEGTSDLQYIWRGAPGAPPPRRRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8snb Structural specializations of the sperm tail.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K382 E385 D386 I389 E390
Binding residue
(residue number reindexed from 1)		K16 E19 D20 I23 E24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0044782 cilium organization
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0031514 motile cilium

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8snb, PDBe:8snb, PDBj:8snb
PDBsum8snb
PubMed37327785
UniProtA0A7M7REB1

[Back to BioLiP]