Structure of PDB 7agx Chain 2F Binding Site BS01

Receptor Information
>7agx Chain 2F (length=72) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYR
NAQSNTVKVFKDIDAAIIQNFR
Ligand information
>7agx Chain 2Q (length=13) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PWSGYLDDVSAKF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7agx Substrate-engaged type III secretion system structures reveal gating mechanism for unfolded protein translocation.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		S39 P41
Binding residue
(residue number reindexed from 1)		S31 P33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042802 identical protein binding
Biological Process
GO:0015031 protein transport
GO:0030254 protein secretion by the type III secretion system
Cellular Component
GO:0005576 extracellular region
GO:0009986 cell surface
GO:0030257 type III protein secretion system complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7agx, PDBe:7agx, PDBj:7agx
PDBsum7agx
PubMed33750771
UniProtP41784|SCTF1_SALTY SPI-1 type 3 secretion system needle filament protein (Gene Name=sctF1)

[Back to BioLiP]