Structure of PDB 8r09 Chain 2B Binding Site BS01

Receptor Information
>8r09 Chain 2B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKM
Ligand information
>8r09 Chain 2 (length=98) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcuucucggccaaguguaguaucuguucuuaucaguuuaauaucugaug
gauuuuuggagcaucgaccugguauugcaguaccuccaggaacggugc
................................<<<<.<....>.>>>>..
..........<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r09 Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution4.3 Å
Binding residue
(original residue number in PDB)
N13 A42 K44 K47 R49 A84 T86 S88
Binding residue
(residue number reindexed from 1)
N11 A40 K42 K45 R47 A82 T84 S86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030619 U1 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8r09, PDBe:8r09, PDBj:8r09
PDBsum8r09
PubMed38778104
UniProtP08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)

[Back to BioLiP]