Structure of PDB 8qzs Chain 2B Binding Site BS01

Receptor Information

>8qzs Chain 2B (length=92) Species: 9606 (Homo sapiens)

IRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQA
FVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKM

Ligand information

>8qzs Chain 2 (length=98)

cgcuucucggccaaguguaguaucuguucuuaucaguuuaauaucugaua
gauuuuuggagcaucgaccugguauugcaguaccuccaggaacggugc

...............................<<<<<.<....>.>>>>>.
..........<<<<<<.<<<<<.............>>>>>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8qzs Structural insights into the cross-exon to cross-intron spliceosome switch
• Resolution: 4.1 Å
• Binding residue (original residue number in PDB): N13 K44 K47 R49 A84 T86 S88
• Binding residue (residue number reindexed from 1): N11 K42 K45 R47 A82 T84 S86

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030619 U1 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0001650 fibrillar center
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0036464 cytoplasmic ribonucleoprotein granule
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:8qzs, PDBe:8qzs, PDBj:8qzs
• PDBsum: 8qzs
• PubMed: 38778104
• UniProt: P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)