Structure of PDB 7ymm Chain 2A Binding Site BS01

Receptor Information
>7ymm Chain 2A (length=284) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASAWERFCSFITSTNNRLYIGWFGVLMIPTLLTAVTCFVIAFIGAPPVDI
DGIREPVAGSLLYGNNIITGAVVPSSNAIGLHLYPIWEAASLDEWLYNGG
PYQLIIFHYMIGCICYLGRQWEYSYRLGMRPWICVAYSAPLAATYSVFLI
YPLGQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMFGVAGVLGGSL
FAAMHGSLVSSTLVNSRSLHFFLGAWPVVCIWLTAMGISTMAFNLNGFNF
NHSIVDSQGNVVNTWADVLNRANLGFEVMHERNA
Ligand information
>7ymm Chain 2T (length=28) Species: 329726 (Acaryochloris marina MBIC11017) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDVIAYVFILACIIGLFFFAVFFREKPT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ymm Structure of a large photosystem II supercomplex from Acaryochloris marina.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
R27 N76 I77
Binding residue
(residue number reindexed from 1)
R17 N66 I67
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ymm, PDBe:7ymm, PDBj:7ymm
PDBsum7ymm
PubMed38394197
UniProtA5A8K9|PSBA2_ACAM1 Photosystem II protein D1 2 (Gene Name=psbA2)

[Back to BioLiP]