Structure of PDB 8hk1 Chain 2 Binding Site BS01

Receptor Information
>8hk1 Chain 2 (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFK
RKYLQGKRGIEKPPFELPDFIKRDIDYQKLHDAFFKWQTKPKLTIHGDLY
YEGKEFEGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLK
IPGLNSPIPPLYGDVFGTNAAEIDRTPWGELE
Ligand information
>8hk1 Chain H (length=148) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccggcuaagaucaaguguaguaucuguucuuaucaguuuaauaucugau
uccucgaggaggauuuuuggagcagggagauggaauaggagcuugcuccg
uccacuccacgcaucgaccugguauugcaguaccuccaggaacggugc
<<..>>...<<.<<.<<<...>>>.>>.>>..<<<<<........>>>>>
<<<<..>>>>...............<<<<.<<<<...<<<<....>>>>.
>>>>>>>>..<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hk1 Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H478 T481 W504 C505 R515 G516
Binding residue
(residue number reindexed from 1)		H21 T24 W47 C48 R58 G59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hk1, PDBe:8hk1, PDBj:8hk1
PDBsum8hk1
PubMed36797247
UniProtQ13435|SF3B2_HUMAN Splicing factor 3B subunit 2 (Gene Name=SF3B2)

[Back to BioLiP]