Structure of PDB 7nvv Chain 2 Binding Site BS01

Receptor Information
>7nvv Chain 2 (length=289) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPP
CITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSD
SLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINQPGFIVVETNYRLYAYT
ESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLR
TRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nvv Structures of mammalian RNA polymerase II pre-initiation complexes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D389 L393 L396
Binding residue
(residue number reindexed from 1)		D220 L224 L227
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001671 ATPase activator activity
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006366 transcription by RNA polymerase II
Cellular Component
GO:0000438 core TFIIH complex portion of holo TFIIH complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvv, PDBe:7nvv, PDBj:7nvv
PDBsum7nvv
PubMed33902107
UniProtQ92759|TF2H4_HUMAN General transcription factor IIH subunit 4 (Gene Name=GTF2H4)

[Back to BioLiP]