Structure of PDB 6ijo Chain 2 Binding Site BS01

Receptor Information
>6ijo Chain 2 (length=173) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPMWYPGATAPAHLDGSMLGDYGFDPLRLGVNKDNLKWFREAELTNGRWA
MAAVVGILFTDAVGLPKFWTAGAEKYALDNQTLALIEVAVFAVLEGKRYE
IYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAV
YGKGPIETLQLHLADPGHNNIYT
Ligand information
>6ijo Chain X (length=26) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ijo Antenna arrangement and energy transfer pathways of a green algal photosystem-I-LHCI supercomplex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y13 Y180 T181
Binding residue
(residue number reindexed from 1)		Y5 Y172 T173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ijo, PDBe:6ijo, PDBj:6ijo
PDBsum6ijo
PubMed30850819
UniProtA8IKC8

[Back to BioLiP]