Structure of PDB 5z58 Chain 2 Binding Site BS01

Receptor Information
>5z58 Chain 2 (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKY
LQGKRGIEKPPFELPDFIKRTGIQEMREQKTMKSKMREKVRPKMGKIDID
YQKLHDAFFKWQLTIHGDLYYEGKEFETRKKPGDLSDELRISLGMPVPPP
WLIAMQRYGPPPSYPNLKIPGLNSPLYGDVFGT
Ligand information
>5z58 Chain F (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z58 Structure of the human activated spliceosome in three conformational states.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		S551 R554 R558 K560
Binding residue
(residue number reindexed from 1)		S84 R87 R91 K93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0005689 U12-type spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z58, PDBe:5z58, PDBj:5z58
PDBsum5z58
PubMed29360106
UniProtQ13435|SF3B2_HUMAN Splicing factor 3B subunit 2 (Gene Name=SF3B2)

[Back to BioLiP]