Structure of PDB 8ugp Chain 1q Binding Site BS01

Receptor Information

>8ugp Chain 1q (length=37) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DGSMVPPEWHRWLHCMTYIWHKFNVSGQQYVPYSTTR

Ligand information

>8ugp Chain 1Q (length=20) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RWENPLMGWSSTADPLSNLV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	P126 S128
Binding residue (residue number reindexed from 1)	P32 S34

Gene Ontology

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane

View graph for
Cellular Component

External links

PDB	RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum	8ugp
PubMed	38811722
UniProt	A0A4X1SJF2

[Back to BioLiP]